Human CSF1, animal component-free

Product Code: GFC0018

Description

Colony stimulating factor 1 (CSF1) is a homodimeric glycoprotein growth factor that regulates proliferation and differentiation of myeloid hematopoietic progenitor cells to mononuclear phagocytic cell lineages, including monocytes, macrophages, and osteoclasts. CSF1 is a crucial factor for the development of tissue-resident macrophages in most tissues. It is required for the maturation and activation of monocytes and macrophages, and regulates inflammatory responses in conjunction with other stimuli such as IFN-γ, LPS, and IL-4. CSF1 is also required for bone resorption by osteoclasts, and is involved in the development and regulation of the placenta, mammary gland, and brain.

Specification

Source
E. coli
Symbols
Colony stimulating factor 1, CSF-1, MCSF
Accession
P09603
AA Sequence
MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS
Molecular Mass
18.5 kDa monomer; 37.1 kDa dimer
Purity
≥ 95%
Bioactivity
The EC50 as determined by a cell proliferation assay using NFS-60 cells is ≤ 10 ng/mL.
Storage
Store at -80°C. Avoid repeated freeze-thaw cycles.
For research or further manufacturing use only. Not for use in humans.

CONTACT US

USA
Europe

ABOUT US

As a pioneer of biotechnology, Creative Bioarray has developed into one of the largest independent biotechnology companies in the world. We are committed to providing our customers with innovative high-quality products and services through discovering, developing, and manufacturing.

Copyright © 2023 Creative Bioarray. All rights reserved.